Printable word search library

Free Printable Word Search Templates

Browse ready-to-print word search puzzles by classroom topic, season, or interest. Each template opens with a puzzle page, answer key, PDF download, Word export, and editable generator controls.

Featured

Popular Printable Starters

Open a template, regenerate a new layout, then print the puzzle and answer key.

MediumGrades 2-512x12Guided activity

Animal Vocabulary

A classroom-ready animal word search with common mammals, birds, and reptiles.

Learning focus: Sort animal names into broad groups and explain a classification choice using a body feature or life process.

LIONTIGERZEBRAKOALARABBIT
Open printable template →
MediumGrades 3-613x13Guided activity

Forest Habitat

Forest vocabulary for trees, woodland animals, and habitat features.

Learning focus: Identify living things and habitat features in a forest scene, then explain how plants and animals use resources there.

FORESTTRAILLEAVESMOSSACORN
Open printable template →
EasyGrades 1-312x12Guided activity

Spelling Practice

A simple printable puzzle for common classroom spelling words.

Learning focus: Notice letter patterns in familiar school words and recall selected spellings after the printed list is covered.

HAPPYSMILEWRITEREADSCHOOL
Open printable template →
MediumGrades 3-614x14Guided activity

Space Science

A printable space puzzle with planets, objects, and exploration terms.

Learning focus: Distinguish space objects from motion and exploration terms, and describe how selected objects relate in a diagram.

PLANETORBITCOMETASTEROIDROCKET
Open printable template →
HardGrades 4-718x18Guided activity

Weather Systems

A weather science worksheet with longer forecast and atmosphere terms.

Learning focus: Read basic weather measurements and connect a dated forecast to atmospheric conditions and larger weather patterns.

TEMPERATUREHUMIDITYPRESSUREFORECASTLIGHTNING
Open printable template →
MediumGrades 2-513x13Guided activity

Summer Camp

A summer activity puzzle with camp, outdoor, and sunshine vocabulary.

Learning focus: Use camp vocabulary to describe outdoor places and sequence activities in a plausible summer day plan.

SUMMERCAMPTRAILCANOECABIN
Open printable template →
MediumGrades 3-613x13Guided activity

Map Skills

Map vocabulary for directions, symbols, and location skills.

Learning focus: Read map directions and symbols, then describe a route on a simple map using its legend and scale.

MAPGLOBECOMPASSLEGENDSCALE
Open printable template →
MediumGrades 2-513x13Guided activity

Sports Day

A printable sports puzzle with games, movement, and team vocabulary.

Learning focus: Distinguish sports, movements, and game terms while describing several roles in a shared class activity.

SOCCERTENNISBASEBALLRUNNINGJUMP
Open printable template →

Directory

Printable Word Search Templates

Choose a theme that matches the lesson, group, or activity. All templates can be edited before printing.

Animals & Nature

Animal vocabulary, habitats, gardens, oceans, and outdoor topics.

6 templates
MediumGrades 2-512x12Guided activity

Animal Vocabulary

A classroom-ready animal word search with common mammals, birds, and reptiles.

Learning focus: Sort animal names into broad groups and explain a classification choice using a body feature or life process.

LIONTIGERZEBRAKOALARABBIT
Open printable template →
MediumGrades 3-613x13Guided activity

Forest Habitat

Forest vocabulary for trees, woodland animals, and habitat features.

Learning focus: Identify living things and habitat features in a forest scene, then explain how plants and animals use resources there.

FORESTTRAILLEAVESMOSSACORN
Open printable template →
MediumGrades 2-513x13Guided activity

Ocean Animals

A printable ocean life puzzle with sea animals and coastal vocabulary.

Learning focus: Separate ocean animals from plants and habitat features, then describe a relationship between an animal and its surroundings.

SHARKWHALEDOLPHINOCTOPUSTURTLE
Open printable template →
EasyGrades 2-411x11Guided activity

Garden Plants

Plant and garden vocabulary for spring lessons or nature centers.

Learning focus: Name plant parts and growing needs, then put seed, sprout, and flowering stages in a sensible order.

SEEDROOTSTEMLEAFFLOWER
Open printable template →
MediumGrades 2-515x15Guided activity

Insects and Bugs

A bug-themed printable puzzle with familiar insect names.

Learning focus: Compare insects with a spider using body features, and recognize a caterpillar as one stage of insect development.

ANTBEEBEETLEMOTHWASP
Open printable template →
EasyGrades 2-512x12Guided activity

Weather Nature

Nature words connected to wind, rain, sun, and sky observations.

Learning focus: Connect weather words to visible sky conditions and describe how wind, water, and light change a scene.

RAINCLOUDWINDSUNSTORM
Open printable template →

Classroom

Spelling, reading, school routines, and teacher-friendly warmups.

6 templates
EasyGrades 1-312x12Guided activity

Spelling Practice

A simple printable puzzle for common classroom spelling words.

Learning focus: Notice letter patterns in familiar school words and recall selected spellings after the printed list is covered.

HAPPYSMILEWRITEREADSCHOOL
Open printable template →
EasyGrades 1-411x11Guided activity

Classroom Objects

A school supplies and classroom objects puzzle for early learners.

Learning focus: Connect classroom object names to their locations and uses, then describe a familiar classroom routine with precise words.

DESKCHAIRBOOKPENCILRULER
Open printable template →
MediumGrades 3-614x14Guided activity

Reading Skills

A reading vocabulary puzzle with story elements and comprehension terms.

Learning focus: Apply story terms to a familiar text and use details to support an inference or short summary.

AUTHORTITLESETTINGPLOTTHEME
Open printable template →
MediumGrades 3-614x14Guided activity

Math Vocabulary

A printable math terms puzzle for operations and geometry review.

Learning focus: Use operation, geometry, representation, and measurement terms accurately when explaining simple problems and classroom diagrams.

ADDSUBTRACTMULTIPLYDIVIDEEQUAL
Open printable template →
EasyGrades 1-412x12Guided activity

School Routines

Daily school routine words for procedures, schedules, and classroom habits.

Learning focus: Sequence familiar school routines and describe how students use cooperative actions during a class day.

ARRIVELINELISTENRAISECLEAN
Open printable template →
MediumGrades 2-513x13Guided activity

Library Day

A library vocabulary puzzle for book checkout days and reading lessons.

Learning focus: Use library words to find, describe, borrow, and return books in a familiar library routine.

LIBRARYSHELFFICTIONPOETRYAUTHOR
Open printable template →

Science

Space, weather, matter, life science, forces, and lab vocabulary.

6 templates
MediumGrades 3-614x14Guided activity

Space Science

A printable space puzzle with planets, objects, and exploration terms.

Learning focus: Distinguish space objects from motion and exploration terms, and describe how selected objects relate in a diagram.

PLANETORBITCOMETASTEROIDROCKET
Open printable template →
HardGrades 4-718x18Guided activity

Weather Systems

A weather science worksheet with longer forecast and atmosphere terms.

Learning focus: Read basic weather measurements and connect a dated forecast to atmospheric conditions and larger weather patterns.

TEMPERATUREHUMIDITYPRESSUREFORECASTLIGHTNING
Open printable template →
MediumGrades 3-614x14Guided activity

Human Body

A life science puzzle with body systems and anatomy terms.

Learning focus: Locate major body structures and explain a simple relationship between two organs, tissues, or systems.

HEARTBRAINLUNGSMUSCLEBONE
Open printable template →
HardGrades 4-715x15Guided activity

Matter and Energy

Physical science vocabulary for states of matter and energy transfer.

Learning focus: Classify states of matter and use property and energy words to explain an observable change.

MATTERSOLIDLIQUIDGASPLASMA
Open printable template →
MediumGrades 3-613x13Guided activity

Simple Machines

Engineering and force terms for a simple machines unit.

Learning focus: Recognize simple machines in familiar classroom objects and explain how a force helps move a load.

LEVERPULLEYWHEELAXLEWEDGE
Open printable template →
MediumGrades 4-813x13Guided activity

Lab Safety

Science safety vocabulary for labs, demonstrations, and experiments.

Learning focus: Recognize protective lab equipment and describe the order of careful observation, measurement, reporting, and cleanup in a teacher-led activity.

GOGGLESGLOVESAPRONSCAUTIONCLEAN
Open printable template →

Holidays & Seasons

Printable activities for seasonal lessons and low-prep celebrations.

6 templates
EasyGrades 1-411x11Guided activity

Spring Flowers

A gentle spring printable puzzle with garden and weather words.

Learning focus: Describe spring changes in plants, weather, and animal activity using observations from a picture or familiar local setting.

SPRINGFLOWERRAINBLOOMBIRD
Open printable template →
MediumGrades 2-513x13Guided activity

Summer Camp

A summer activity puzzle with camp, outdoor, and sunshine vocabulary.

Learning focus: Use camp vocabulary to describe outdoor places and sequence activities in a plausible summer day plan.

SUMMERCAMPTRAILCANOECABIN
Open printable template →
MediumGrades 2-514x14Guided activity

Fall Harvest

A cozy fall puzzle with harvest, leaves, and seasonal vocabulary.

Learning focus: Connect fall observations to crops and tree changes, then describe a seasonal scene with accurate vocabulary.

AUTUMNHARVESTLEAVESPUMPKINAPPLE
Open printable template →
EasyGrades 1-412x12Guided activity

Winter Fun

A winter activity puzzle with snow, cold weather, and cozy words.

Learning focus: Sort winter weather, clothing, and activity words and use selected terms to describe a particular winter scene.

WINTERSNOWMITTENSCARFCOCOA
Open printable template →
MediumGrades 2-513x13Guided activity

Halloween Classroom

A classroom-safe Halloween vocabulary puzzle with playful seasonal words.

Learning focus: Describe a playful Halloween classroom scene using precise costume, color, animal, and celebration words from the puzzle.

COSTUMEPUMPKINCANDYMASKPARADE
Open printable template →
MediumGrades 2-514x14Guided activity

Thanksgiving Gratitude

A gratitude-focused seasonal puzzle for Thanksgiving week.

Learning focus: Use gratitude and sharing words in a fictional scenario and distinguish actions from seasonal food terms.

THANKSFAMILYFRIENDHARVESTFEAST
Open printable template →

Geography & Social Studies

Maps, communities, landmarks, government, and history vocabulary.

6 templates
MediumGrades 3-613x13Guided activity

Map Skills

Map vocabulary for directions, symbols, and location skills.

Learning focus: Read map directions and symbols, then describe a route on a simple map using its legend and scale.

MAPGLOBECOMPASSLEGENDSCALE
Open printable template →
MediumGrades 3-615x15Guided activity

US Landmarks

A printable landmarks puzzle with familiar US places and civic symbols.

Learning focus: Locate selected US landmarks on a map and distinguish natural landforms from constructed or historic sites.

LIBERTYLINCOLNCANYONRUSHMOREYELLOWSTONE
Open printable template →
EasyGrades 1-412x12Guided activity

Community Helpers

A social studies puzzle with jobs and community service vocabulary.

Learning focus: Connect community job titles to the services and skills people bring to familiar everyday situations and events.

TEACHERDOCTORNURSEFARMERMAYOR
Open printable template →
HardGrades 4-716x16Guided activity

World Geography

A geography terms puzzle for continents, landforms, and water features.

Learning focus: Distinguish political areas, physical features, and location lines while describing selected places on a world map.

CONTINENTCOUNTRYOCEANRIVERMOUNTAIN
Open printable template →
MediumGrades 4-714x14Guided activity

Government Basics

Civics vocabulary for basic government roles, rights, and responsibilities.

Learning focus: Identify civic roles and public processes, then use rights and responsibility terms in a specific example.

CITIZENVOTELAWCOURTMAYOR
Open printable template →
HardGrades 4-718x18Guided activity

Ancient History

A history vocabulary puzzle with ancient civilizations and artifacts.

Learning focus: Connect ancient places, roles, buildings, and artifacts to a specific historical source from the civilization currently studied.

ANCIENTEMPIRETEMPLESCRIBEPAPYRUS
Open printable template →

Food & Hobbies

Cooking, sports, music, art, travel, and everyday interest themes.

6 templates
EasyGrades 2-512x12Guided activity

Healthy Foods

A food vocabulary puzzle with fruits, vegetables, grains, and proteins.

Learning focus: Sort familiar foods into broad groups and describe variety in a fictional meal or snack.

APPLECARROTBEANSRICEYOGURT
Open printable template →
MediumGrades 3-613x13Guided activity

Cooking Tools

A kitchen vocabulary puzzle with tools, actions, and cooking basics.

Learning focus: Connect cooking tools with appropriate actions, then use recipe vocabulary to plan and sequence a simple preparation task.

SPOONWHISKBOWLOVENPAN
Open printable template →
MediumGrades 2-513x13Guided activity

Sports Day

A printable sports puzzle with games, movement, and team vocabulary.

Learning focus: Distinguish sports, movements, and game terms while describing several roles in a shared class activity.

SOCCERTENNISBASEBALLRUNNINGJUMP
Open printable template →
MediumGrades 2-613x13Guided activity

Music Class

A music vocabulary puzzle with instruments and notation terms.

Learning focus: Name instruments and musical groups, then describe rhythm, melody, or tempo in a short example.

MUSICPIANODRUMGUITARVIOLIN
Open printable template →
MediumGrades 2-613x13Guided activity

Art Studio

An art vocabulary puzzle with tools, colors, and creative actions.

Learning focus: Connect art materials with visual elements and use the vocabulary to describe or plan an artwork.

PAINTBRUSHCANVASCOLORSKETCH
Open printable template →
MediumGrades 3-614x14Guided activity

Travel Adventure

A travel-themed puzzle with transportation, packing, and trip words.

Learning focus: Plan and sequence a fictional journey using transport, destination, and preparation words in an accurate itinerary.

TRAVELTICKETPACKTRAINPLANE
Open printable template →

Print workflow

From Template to Worksheet

The printable pages reuse the same generator and export tools as the custom word search maker.

1. Pick a theme

Start with a vetted word list and recommended grid settings.

2. Review the puzzle

Check the generated grid, answer key, skipped words, and difficulty.

3. Customize if needed

Edit the title, words, rows, columns, and allowed directions.

4. Print or export

Use browser print, PDF, Word, Copy Puzzle, or Copy Answer Key.

Need a number-logic worksheet instead? Try the free Sudoku Generator for printable 9x9 puzzles with answer keys.

Printable Word Search FAQ

Are these printable word searches free?

Yes. The templates are free to open, generate, print, download as PDF, or export as a Microsoft Word file.

Do the printable pages include answer keys?

Yes. Each template opens with a puzzle page and an answer key page. You can hide the answer key on screen, print both pages, or download the file.

Can I edit the word list?

Yes. Open any template and change the title, word list, grid size, max words, or allowed directions before regenerating the puzzle.

Can teachers use these in class?

Yes. The templates are built for classroom-style use cases, but you should review the word list and answer key before copying or sharing with students.

Make your own printable crossword

Add your own answers and clues, review what fit, then print the puzzle with a separate answer key.

Create a Crossword